PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g070510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 1705aa    MW: 191472 Da    PI: 5.0935
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g070510.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.45e-182480157
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    ++kR   t+ qle+Le+ ++ ++yps++ r++L+ kl+L++rq ++WF+ rR k++k
  Csa11g070510.1 24 KSKRKMKTAAQLEVLETTYAAEPYPSEAIRADLSVKLNLSDRQLQMWFCHRRLKDRK 80
                    679****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-161180IPR009057Homeodomain-like
SuperFamilySSF466898.13E-151880IPR009057Homeodomain-like
PROSITE profilePS5007116.2442181IPR001356Homeobox domain
SMARTSM003899.7E-162385IPR001356Homeobox domain
CDDcd000866.56E-132481No hitNo description
PfamPF000461.2E-152480IPR001356Homeobox domain
SMARTSM005712.0E-22535594IPR018501DDT domain
PROSITE profilePS5082715.784535594IPR018501DDT domain
PfamPF027911.7E-16536591IPR018501DDT domain
PfamPF050661.2E-15717785IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.6E-6920961IPR028942WHIM1 domain
PfamPF156133.9E-1310931165IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1705 aa     Download sequence    Send to blast
MEGGSDEATV KNTKTTPEEG GESKSKRKMK TAAQLEVLET TYAAEPYPSE AIRADLSVKL  60
NLSDRQLQMW FCHRRLKDRK STTTTTTPSS KRQRKELITP PMAVESPKPA VNAADLVAGN  120
DFDSRRAVRV SGGSGSGGVT VVKRFNEPSS AEVRAVGYME AQLGERLRDN GPILGMEFDP  180
LPPGAFGMPI EMPSHRKATR QAFETSLYVR SDVKPNKDVR PIREYQFLPD LPSSRTDHSE  240
RVSPSHHYGV PLDASVMRAS AVSAGHRGDY KISPQIPNLN LATHQGKPGH VYSPNLPEYD  300
SPYQKSYMDT PAQRNLNDHP IHEEPFVKSE REVGNEDEDD DALQLERKRK NEEARISREL  360
EAHEKRIRRE LEKQDMLRRK REEQLRKEME RQDRERRKEE ERLLRERQRE EERFMKEQMR  420
ELQRREKFLK KETMRAEKMR QKEEMRREKE VARLKAANER AIARKIAKES MELIEDERLE  480
LMEVAALTKG LPSMLALDFE TLQNLDEYRD KQVLFPPSSV KLKKPFTVKP WNGSDENVAN  540
LLMVWRFLIT FADVFGLWPF TLDEFAQAFH DYDPRLMGEI HIVLLKTIIK DIEGVTRTLL  600
TGVGANQNAA SNPGGGHPHV VEGAYAWGFD IRSWRRNLNV FTWPEILRQL ALSAGLGPQL  660
KKRNIKTVSV HDENEANDSE NVIFNLRKGV AAENAFAKMQ ERGLSNPKRS RHRLTPGTVK  720
FAAFHVLSLE GEKGLTILDV AEKIQRSGLR DLTTSRTPEA SVAAALSRDT KLFERVAPST  780
YCVRASYRKE AGGAETILAE AREKIRAFKS GITDLEDVDD AERDEDSESD VGDDPEVDLH  840
LKKEDPDALE IENSIKVEPV LENGKLDTVT MKTKAGLPIT PSLPEDIKDE KRDDILVDQS  900
LEDAVANDAD SACFDESKLG EQWVQGLVEG DYSNLSSEER LNALVALIGI AIEGNTIRVA  960
LEERLEVAST LKKQMWGEVQ LDKRWKEESL LRANYLSYPT AKPGVNIATP ASGNQESSSA  1020
DVTPISSQDP LSLPQMDVNN VIAGPSLQLQ ENVSGMENLQ YQQQGGYTAD RERLRAQLKA  1080
YVGYKAEELY VYRSLPLGQD RRRNRYWRFS ASASRNDPGC GRIFVELQDG RWRLIDSEED  1140
FDYLVKSLDV RGVRESHLHF MLLKIEASFK EAVRKNVEAN PGLCSVSSSL DSDTAEISTT  1200
FKIELGDSNA IERCSVLQRF QSFEKWMWDN MLHPGALSAF KYGAKQSSPL FRICRTCAGL  1260
HLLEDICCPS CGQKSDVGEL CFADQVAQLG DYSRGGDTGF ILRSSISSPL RIRLLKIQLA  1320
LVEASLPPEG LEAFWTENHR KSWGVKLLSS SSVEELNQVL TTLEVALKRD FLSSNFETTS  1380
ELLGLPEEAL ASDLTCVVNV LPWIPKTTGG VALRLFEFDS AIVYTPDQNN DPLKDKESED  1440
LVGLETNLLR NVPEKDVMET PVQGGYTQEE NWTDPGLGGV SSSGRGGRPP RGRGRPRSRG  1500
SGGNGKKPAV SSSRPPRGAA NTNGETMLRP RAQPRGKKNG RRSSIKGRKR PTKGTLRISN  1560
EVVGGRLAKE VAVTAKTTLP DNEDDWIETP ELQDDDGEAS SSGRSFQYKD YDDDEVMAPM  1620
DDFDDGGESS KLVGRGEFSL HSDDEYEEED EEEEEEEDMN TKMDVDYIND DSFGRREQPE  1680
ISNDAARKRF MFDDPDLTSS SSSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
115361550KKNGRRSSIKGRKRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0052390.0AB005239.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MLN1.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010441920.10.0PREDICTED: uncharacterized protein LOC104725024
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLR0EUK20.0R0EUK2_9BRAS; Uncharacterized protein
STRINGAT5G44180.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96012530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator